Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium-dependent dopamine transporter (SC6A3), partial

This Recombinant Human Sodium-dependent dopamine transporter (SC6A3), partial spans the amino acid sequence from region 172-236. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium-dependent dopamine transporter; DA transporter; DAT; Solute carrier family 6 member 3; SLC6A3 DAT1

UniProt

Q01959

Expression Region

172-236

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

TTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB3IP Protein Vector (Mouse) (pPM-C-His)
PV221773 500 ng

RAB3IP Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus UPF0297 protein SAS1553 (SAS1553)
MBS1424746-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus UPF0297 protein SAS1553 (SAS1553)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus UPF0297 protein SAS1553 (SAS1553)
MBS1424746-02 0.1 mg (E-Coli)

Recombinant Staphylococcus aureus UPF0297 protein SAS1553 (SAS1553)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus UPF0297 protein SAS1553 (SAS1553)
MBS1424746-03 0.02 mg (Yeast)

Recombinant Staphylococcus aureus UPF0297 protein SAS1553 (SAS1553)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus UPF0297 protein SAS1553 (SAS1553)
MBS1424746-04 0.1 mg (Yeast)

Recombinant Staphylococcus aureus UPF0297 protein SAS1553 (SAS1553)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus UPF0297 protein SAS1553 (SAS1553)
MBS1424746-05 0.02 mg (Baculovirus)

Recombinant Staphylococcus aureus UPF0297 protein SAS1553 (SAS1553)

Sign In for Pricing
View Details