Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome c oxidase subunit 6A2, mitochondrial (CX6A2), partial

This Recombinant Human Cytochrome c oxidase subunit 6A2, mitochondrial (CX6A2), partial spans the amino acid sequence from region 50-97. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 6A2, mitochondrial; Cytochrome c oxidase polypeptide VIa-heart; COXVIAH; Cytochrome c oxidase subunit VIA-muscle; COX VIa-M; COX6A2 COX6A COX6AH

UniProt

Q02221

Expression Region

50-97

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HSGHRPRPEFRPYQHLRIRTKPYPWGDGNHTLFHNSHVNPLPTGYEHP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DprE1-IN-10
HY-158700 1 Each

DprE1-IN-10

Sign In for Pricing
View Details
Cnpy4 (NM_001108852) Rat Untagged Clone
RN207527 10 µg

Cnpy4 (NM_001108852) Rat Untagged Clone

Sign In for Pricing
View Details
Human GSK3B Protein
orb425881-01 2 µg

Human GSK3B Protein

Sign In for Pricing
View Details
Human GSK3B Protein
orb425881-02 10 µg

Human GSK3B Protein

Sign In for Pricing
View Details
Human GSK3B Protein
orb425881-03 1 mg

Human GSK3B Protein

Sign In for Pricing
View Details
POTEC sgRNA CRISPR Lentivector (Human) (Target 1)
K1689402 1.0 µg DNA

POTEC sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details