Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Helix-loop-helix protein 2 (HEN2)

This Recombinant Human Helix-loop-helix protein 2 (HEN2) spans the amino acid sequence from region 1-135. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Helix-loop-helix protein 2; HEN-2; Class A basic helix-loop-helix protein 34; bHLHa34; Nescient helix loop helix 2; NSCL-2; NHLH2 BHLHA34 HEN2 KIAA0490

UniProt

Q02577

Expression Region

1-135

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MMLSPDQAADSDHPSSAHSDPESLGGTDTKVLGSVSDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrin beta 4 (ITGB4) Mouse Monoclonal Antibody [Clone ID: 450-9D]
SM1205P 200 µg

Integrin beta 4 (ITGB4) Mouse Monoclonal Antibody [Clone ID: 450-9D]

Sign In for Pricing
View Details
NSUN5C (NSUN5P2, WBSCR20B, WBSCR20C, Putative Methyltransferase NSUN5C, NOL1/NOP2/Sun Domain Family Member 5C, Williams-Beuren Syndrome Chromosomal Region 20C Protein, DKFZp434K058, DKFZp666P104, FLJ11626, MGC129801, MGC15057) (MaxLight 550)
138195-ML550 100 µL

NSUN5C (NSUN5P2, WBSCR20B, WBSCR20C, Putative Methyltransferase NSUN5C, NOL1/NOP2/Sun Domain Family Member 5C, Williams-Beuren Syndrome Chromosomal Region 20C Protein, DKFZp434K058, DKFZp666P104, FLJ11626, MGC129801, MGC15057) (MaxLight 550)

Sign In for Pricing
View Details
Bmp10 Rat shRNA Plasmid (Locus ID 500245)
TR703167 1 Kit

Bmp10 Rat shRNA Plasmid (Locus ID 500245)

Sign In for Pricing
View Details
Bovine Kinesin-like protein KIF3C, KIF3C ELISA KIT
ELI-23752b 96 Tests

Bovine Kinesin-like protein KIF3C, KIF3C ELISA KIT

Sign In for Pricing
View Details
OR7D4 Human Gene Knockout Kit (CRISPR)
KN420262 1 Kit

OR7D4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dicer Antibody
DF7706-01 100 µL

Dicer Antibody

Sign In for Pricing
View Details