Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Guanylin (GUC2A)

This Recombinant Human Guanylin (GUC2A) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Guanylin; Guanylate cyclase activator 2A; Guanylate cyclase-activating protein 1; Guanylate cyclase-activating protein I; GCAP-I; [Cleaved into: HMW-guanylin; Guanylin] GUCA2A GUCA2

UniProt

Q02747

Expression Region

22-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VTVQDGNFSFSLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Parathyroid Hormone/Parathyroid Hormone Related Protein Receptor (PTH/PTHrP Receptor) (AP)
MBS6241556-01 0.1 mL

Parathyroid Hormone/Parathyroid Hormone Related Protein Receptor (PTH/PTHrP Receptor) (AP)

Sign In for Pricing
View Details
Parathyroid Hormone/Parathyroid Hormone Related Protein Receptor (PTH/PTHrP Receptor) (AP)
MBS6241556-02 5x 0.1 mL

Parathyroid Hormone/Parathyroid Hormone Related Protein Receptor (PTH/PTHrP Receptor) (AP)

Sign In for Pricing
View Details
OR11A1 (m) -PR
sc-106326-PR 10 µM - 20 µL

OR11A1 (m) -PR

Sign In for Pricing
View Details
PPA1 (Inorganic Pyrophosphatase 1, IOPPP, IPP1, PP1, PPase)
052255 100 µg

PPA1 (Inorganic Pyrophosphatase 1, IOPPP, IPP1, PP1, PPase)

Sign In for Pricing
View Details
Anti-SGT2/SGTB Antibody Picoband®, HRP Conjugate
A13056-1-HRP 100 µg/Vial

Anti-SGT2/SGTB Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
DRAM2 (DNA Damage-regulated Autophagy Modulator Protein 2, Transmembrane Protein 77, TMEM77, PSEC0031, UNQ154/PRO180) (MaxLight 650)
MBS6246781-01 0.1 mL

DRAM2 (DNA Damage-regulated Autophagy Modulator Protein 2, Transmembrane Protein 77, TMEM77, PSEC0031, UNQ154/PRO180) (MaxLight 650)

Sign In for Pricing
View Details