Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Guanylin (GUC2A)

This Recombinant Human Guanylin (GUC2A) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Guanylin; Guanylate cyclase activator 2A; Guanylate cyclase-activating protein 1; Guanylate cyclase-activating protein I; GCAP-I; [Cleaved into: HMW-guanylin; Guanylin] GUCA2A GUCA2

UniProt

Q02747

Expression Region

22-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VTVQDGNFSFSLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DIRAS1 Antibody
CSB-PA550322 100 µL

DIRAS1 Antibody

Sign In for Pricing
View Details
EDN1 Antibody
orb1274365 100 µL

EDN1 Antibody

Sign In for Pricing
View Details
TEKT1 Antibody
CSB-PA023376GA01HU 100 µL

TEKT1 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal ATG9B Antibody [Alexa Fluor 350]
NBP1-77169AF350 0.1 mL

Rabbit Polyclonal ATG9B Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
EIF2B4 Adenovirus (Mouse)
19085054 1.0 mL

EIF2B4 Adenovirus (Mouse)

Sign In for Pricing
View Details
[IHC]MGMT Mouse Monoclonal Antibody, 1 pack = 100 µL
BAL3940 1 Each

[IHC]MGMT Mouse Monoclonal Antibody, 1 pack = 100 µL

Sign In for Pricing
View Details