Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 6-pyruvoyl tetrahydrobiopterin synthase (PTPS)

This Recombinant Human 6-pyruvoyl tetrahydrobiopterin synthase (PTPS) spans the amino acid sequence from region 1-145. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

6-pyruvoyl tetrahydrobiopterin synthase; PTP synthase; PTPS; EC 4.2.3.12; PTS

UniProt

Q03393

Expression Region

1-145

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSTEGGGRRCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMVMNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYIWDNLQKVLPVGVLYKVKVYETDNNIVVYKGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

A1 Broth (A-1 Medium)
38515-01 100 g

A1 Broth (A-1 Medium)

Sign In for Pricing
View Details
A1 Broth (A-1 Medium)
38515-02 500 g

A1 Broth (A-1 Medium)

Sign In for Pricing
View Details
Mmu-miR-7649-5p agomir
HY-R04048A-01 5 nmol

Mmu-miR-7649-5p agomir

Sign In for Pricing
View Details
Mmu-miR-7649-5p agomir
HY-R04048A-02 20 nmol

Mmu-miR-7649-5p agomir

Sign In for Pricing
View Details
CENPM Rabbit Polyclonal Antibody (BF350)
orb2520827 100 µL

CENPM Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Olr729 AAV siRNA Pooled Vector
34635166 1.0 µg

Olr729 AAV siRNA Pooled Vector

Sign In for Pricing
View Details