Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Antigen peptide transporter 2 (TAP2), partial

This Recombinant Human Antigen peptide transporter 2 (TAP2), partial spans the amino acid sequence from region 430-686. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Antigen peptide transporter 2; APT2; EC 7.4.2.14; ATP-binding cassette sub-family B member 3; Peptide supply factor 2; Peptide transporter PSF2; PSF-2; Peptide transporter TAP2; Peptide transporter involved in antigen processing 2; Really interesting new gene 11 protein; RING11; TAP2 ABCB3 PSF2 RING11 Y1

UniProt

Q03519

Expression Region

430-686

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YGDMLSNVGAAEKVFSYMDRQPNLPSPGTLAPTTLQGVVKFQDVSFAYPNRPDRPVLKGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHCYLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSRGDRTVLVIAHRLQTVQRAHQILVLQEGKLQKLAQL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Oxoacyl-[Acyl-Carrier-Protein] Synthase 2 (FABF) Antibody (Biotin)
abx300717-01 20 µg

3-Oxoacyl-[Acyl-Carrier-Protein] Synthase 2 (FABF) Antibody (Biotin)

Sign In for Pricing
View Details
3-Oxoacyl-[Acyl-Carrier-Protein] Synthase 2 (FABF) Antibody (Biotin)
abx300717-02 50 µg

3-Oxoacyl-[Acyl-Carrier-Protein] Synthase 2 (FABF) Antibody (Biotin)

Sign In for Pricing
View Details
3-Oxoacyl-[Acyl-Carrier-Protein] Synthase 2 (FABF) Antibody (Biotin)
abx300717-03 100 µg

3-Oxoacyl-[Acyl-Carrier-Protein] Synthase 2 (FABF) Antibody (Biotin)

Sign In for Pricing
View Details
3-Oxoacyl-[Acyl-Carrier-Protein] Synthase 2 (FABF) Antibody (Biotin)
abx300717-04 200 µg

3-Oxoacyl-[Acyl-Carrier-Protein] Synthase 2 (FABF) Antibody (Biotin)

Sign In for Pricing
View Details
3-Oxoacyl-[Acyl-Carrier-Protein] Synthase 2 (FABF) Antibody (Biotin)
abx300717-05 1 mg

3-Oxoacyl-[Acyl-Carrier-Protein] Synthase 2 (FABF) Antibody (Biotin)

Sign In for Pricing
View Details
LRRT4 rabbit pAb
E44H16298 100 µL

LRRT4 rabbit pAb

Sign In for Pricing
View Details