Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Collagen alpha-1 (X) chain (COAA1)

This Recombinant Human Collagen alpha-1 (X) chain (COAA1) spans the amino acid sequence from region 19-680. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Collagen alpha-1 (X; chain COL10A1

UniProt

Q03692

Expression Region

19-680

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VFYAERYQMPTGIKGPLPNTKTQFFIPYTIKSKGIAVRGEQGTPGPPGPAGPRGHPGPSGPPGKPGYGSPGLQGEPGLPGPPGPSAVGKPGVPGLPGKPGERGPYGPKGDVGPAGLPGPRGPPGPPGIPGPAGISVPGKPGQQGPTGAPGPRGFPGEKGAPGVPGMNGQKGEMGYGAPGRPGERGLPGPQGPTGPSGPPGVGKRGENGVPGQPGIKGDRGFPGEMGPIGPPGPQGPPGERGPEGIGKPGAAGAPGQPGIPGTKGLPGAPGIAGPPGPPGFGKPGLPGLKGERGPAGLPGGPGAKGEQGPAGLPGKPGLTGPPGNMGPQGPKGIPGSHGLPGPKGETGPAGPAGYPGAKGERGSPGSDGKPGYPGKPGLDGPKGNPGLPGPKGDPGVGGPPGLPGPVGPAGAKGMPGHNGEAGPRGAPGIPGTRGPIGPPGIPGFPGSKGDPGSPGPPGPAGIATKGLNGPTGPPGPPGPRGHSGEPGLPGPPGPPGPPGQAVMPEGFIKAGQRPSLSGTPLVSANQGVTGMPVSAFTVILSKAYPAIGTPIPFDKILYNRQQHYDPRTGIFTCQIPGIYYFSYHVHVKGTHVWVGLYKNGTPVMYTYDEYTKGYLDQASGSAIIDLTENDQVWLQLPNAESNGLYSSEYVHSSFSGFLVAPM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pask (NM_080850) Mouse Recombinant Protein
PM43863M5 20 µg

Pask (NM_080850) Mouse Recombinant Protein

Sign In for Pricing
View Details
α-Hydroxy-cyclohexanemethanesulfonic Acid-d11 Sodium Salt
013413 5 mg

α-Hydroxy-cyclohexanemethanesulfonic Acid-d11 Sodium Salt

Sign In for Pricing
View Details
PHF2P2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV740266 1.0 µg DNA

PHF2P2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Gm7325 (Mymx) (NM_001177470) Mouse Tagged ORF Clone Lentiviral Particle
MR224234L4V 200 µL

Gm7325 (Mymx) (NM_001177470) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Rat Bifunctional apoptosis regulator (Bfar)
MBS7010386-01 0.02 mg

Recombinant Rat Bifunctional apoptosis regulator (Bfar)

Sign In for Pricing
View Details
Recombinant Rat Bifunctional apoptosis regulator (Bfar)
MBS7010386-02 0.1 mg

Recombinant Rat Bifunctional apoptosis regulator (Bfar)

Sign In for Pricing
View Details