Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Copper-transporting ATPase 1 (ATP7A), partial

This Recombinant Human Copper-transporting ATPase 1 (ATP7A), partial spans the amino acid sequence from region 676-714. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Copper-transporting ATPase 1; EC 7.2.2.8; Copper pump 1; Menkes disease-associated protein; ATP7A MC1 MNK

UniProt

Q04656

Expression Region

676-714

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HHFATLHHNQNMSKEEMINLHSSMFLERQILPGLSVMNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CHST7 shRNA (UAS) - Lentiviral human CHST7 shRNA (UAS, GFP) (100)
GTR15345276 1 Vial

Lentiviral human CHST7 shRNA (UAS) - Lentiviral human CHST7 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Rbp7 Mouse shRNA Lentiviral Particle (Locus ID 63954)
TL512374V 500 µL Each

Rbp7 Mouse shRNA Lentiviral Particle (Locus ID 63954)

Sign In for Pricing
View Details
Human S100 Calcium Binding Protein P (S100P) ELISA Kit
MBS9714422-01 48 Tests

Human S100 Calcium Binding Protein P (S100P) ELISA Kit

Sign In for Pricing
View Details
Human S100 Calcium Binding Protein P (S100P) ELISA Kit
MBS9714422-02 96 Tests

Human S100 Calcium Binding Protein P (S100P) ELISA Kit

Sign In for Pricing
View Details
Human S100 Calcium Binding Protein P (S100P) ELISA Kit
MBS9714422-03 5x 96 Tests

Human S100 Calcium Binding Protein P (S100P) ELISA Kit

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD183/CXCR3 Antibody[CXCR3-173]
E-AB-F1114UJ-01 25 µg

PerCP/Cyanine5.5 Anti-Mouse CD183/CXCR3 Antibody[CXCR3-173]

Sign In for Pricing
View Details