Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sex-determining region Y protein (SRY)

This Recombinant Human Sex-determining region Y protein (SRY) spans the amino acid sequence from region 1-204. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sex-determining region Y protein; Testis-determining factor; SRY TDF

UniProt

Q05066

Expression Region

1-204

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYRPRRKAKMLPKNCSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQLGHLPPINAASSPQQRDRYSHWTKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRIP3 (1-241, His-tag) Human Protein
AR50816PU-S 50 µg

NRIP3 (1-241, His-tag) Human Protein

Sign In for Pricing
View Details
9- (2'-Deoxy-5'-O-DMT-2'-fluoro-b-D-arabinofuranosyl) -N2-isobutyrylguanine 3'-O-succinate triethylammonium salt
295891-01 10 mg

9- (2'-Deoxy-5'-O-DMT-2'-fluoro-b-D-arabinofuranosyl) -N2-isobutyrylguanine 3'-O-succinate triethylammonium salt

Sign In for Pricing
View Details
9- (2'-Deoxy-5'-O-DMT-2'-fluoro-b-D-arabinofuranosyl) -N2-isobutyrylguanine 3'-O-succinate triethylammonium salt
295891-02 25 mg

9- (2'-Deoxy-5'-O-DMT-2'-fluoro-b-D-arabinofuranosyl) -N2-isobutyrylguanine 3'-O-succinate triethylammonium salt

Sign In for Pricing
View Details
9- (2'-Deoxy-5'-O-DMT-2'-fluoro-b-D-arabinofuranosyl) -N2-isobutyrylguanine 3'-O-succinate triethylammonium salt
295891-03 50 mg

9- (2'-Deoxy-5'-O-DMT-2'-fluoro-b-D-arabinofuranosyl) -N2-isobutyrylguanine 3'-O-succinate triethylammonium salt

Sign In for Pricing
View Details
9- (2'-Deoxy-5'-O-DMT-2'-fluoro-b-D-arabinofuranosyl) -N2-isobutyrylguanine 3'-O-succinate triethylammonium salt
295891-04 100 mg

9- (2'-Deoxy-5'-O-DMT-2'-fluoro-b-D-arabinofuranosyl) -N2-isobutyrylguanine 3'-O-succinate triethylammonium salt

Sign In for Pricing
View Details
9- (2'-Deoxy-5'-O-DMT-2'-fluoro-b-D-arabinofuranosyl) -N2-isobutyrylguanine 3'-O-succinate triethylammonium salt
295891-05 250 mg

9- (2'-Deoxy-5'-O-DMT-2'-fluoro-b-D-arabinofuranosyl) -N2-isobutyrylguanine 3'-O-succinate triethylammonium salt

Sign In for Pricing
View Details