Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin-protein ligase E3A (UBE3A), partial

This Recombinant Human Ubiquitin-protein ligase E3A (UBE3A), partial spans the amino acid sequence from region 776-875. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ubiquitin-protein ligase E3A; EC 2.3.2.26; E6AP ubiquitin-protein ligase; HECT-type ubiquitin transferase E3A; Human papillomavirus E6-associated protein; Oncogenic protein-associated protein E6-AP; Renal carcinoma antigen NY-REN-54; UBE3A E6AP EPVE6AP HPVE6A

UniProt

Q05086

Expression Region

776-875

Origin

Homo sapiens (Human)

Field of Research

Molecular Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YDGGYTRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lymphocyte Activation Gene 3 (LAG-3) (Negative Checkpoint Regulator) (LAG3/3261), 0.2mg/mL
BNUB3261-100 1x 100 µL

Lymphocyte Activation Gene 3 (LAG-3) (Negative Checkpoint Regulator) (LAG3/3261), 0.2mg/mL

Sign In for Pricing
View Details
14-3-3 Sigma / Stratifin (CPTC-SFN-2), 1mg/mL
BNUM2481-50 1x 50 µL

14-3-3 Sigma / Stratifin (CPTC-SFN-2), 1mg/mL

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (rSOX9/2288), Biotin conjugate, 0.1mg/mL
BNCB2288-100 1x 100 µL

SOX9 / SRY-box 9 (rSOX9/2288), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant IGFBP1 Antibody
RC-4752-01 50 μL

Recombinant IGFBP1 Antibody

Sign In for Pricing
View Details
Recombinant IGFBP1 Antibody
RC-4752-02 100 µL

Recombinant IGFBP1 Antibody

Sign In for Pricing
View Details
Recombinant IGFBP1 Antibody
RC-4752-03 1 mL

Recombinant IGFBP1 Antibody

Sign In for Pricing
View Details