Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin-protein ligase E3A (UBE3A), partial

This Recombinant Human Ubiquitin-protein ligase E3A (UBE3A), partial spans the amino acid sequence from region 776-875. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ubiquitin-protein ligase E3A; EC 2.3.2.26; E6AP ubiquitin-protein ligase; HECT-type ubiquitin transferase E3A; Human papillomavirus E6-associated protein; Oncogenic protein-associated protein E6-AP; Renal carcinoma antigen NY-REN-54; UBE3A E6AP EPVE6AP HPVE6A

UniProt

Q05086

Expression Region

776-875

Origin

Homo sapiens (Human)

Field of Research

Molecular Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YDGGYTRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alkaline Phosphatase Conjugated Phytolacca americana Lectin (Pokeweed) -PWMPWA-
LA-1901-1 1 mg

Alkaline Phosphatase Conjugated Phytolacca americana Lectin (Pokeweed) -PWMPWA-

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS809348 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Green Fluorescent FAM-Phe-CMK Serine Protease Assay Kit
945 25 Tests

Green Fluorescent FAM-Phe-CMK Serine Protease Assay Kit

Sign In for Pricing
View Details
Commd7 Mouse Gene Knockout Kit (CRISPR)
KN503669 1 Kit

Commd7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (MUC1/520), CF405S conjugate, 0.1mg/mL
BNC040520-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (MUC1/520), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Climatic Chamber BCCL-1417
BCCL-1417 1 Unit

Climatic Chamber BCCL-1417

Sign In for Pricing
View Details