Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ubiquitin-protein ligase E3A (UBE3A), partial

This Recombinant Human Ubiquitin-protein ligase E3A (UBE3A), partial spans the amino acid sequence from region 776-875. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ubiquitin-protein ligase E3A; EC 2.3.2.26; E6AP ubiquitin-protein ligase; HECT-type ubiquitin transferase E3A; Human papillomavirus E6-associated protein; Oncogenic protein-associated protein E6-AP; Renal carcinoma antigen NY-REN-54; UBE3A E6AP EPVE6AP HPVE6A

UniProt

Q05086

Expression Region

776-875

Origin

Homo sapiens (Human)

Field of Research

Molecular Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YDGGYTRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB3C Protein Vector (Mouse) (pPM-C-HA)
38335024 500 ng

RAB3C Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
DTX3 Rabbit pAb, AP conjugated
orb2864310 100 µL

DTX3 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
Tumor Necrosis Factor Ligand Superfamily Member 13B / BAFF (TNFSF13B) Antibody
abx238829 100 µg

Tumor Necrosis Factor Ligand Superfamily Member 13B / BAFF (TNFSF13B) Antibody

Sign In for Pricing
View Details
CTRB1 Antibody
A50560-100UG 100 µg

CTRB1 Antibody

Sign In for Pricing
View Details
CVL/EZR (Cytovillin/Ezrin) BioAssayTM ELISA Kit (Human) discontinued
382563 96 Tests

CVL/EZR (Cytovillin/Ezrin) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
H2AFY2 Protein Lysate (Rat) with C-HA Tag
22954036 100 µg

H2AFY2 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details