Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Collagen alpha-1 (XIV) chain (COEA1), partial

This Recombinant Human Collagen alpha-1 (XIV) chain (COEA1), partial spans the amino acid sequence from region 1229-1424. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Collagen alpha-1 (XIV; chain; Undulin; COL14A1 UND

UniProt

Q05707

Expression Region

1229-1424

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GFKMMEMFGLVEKDFSSVEGVSMEPGTFNVFPCYQLHKDALVSQPTRYLHPEGLPSDYTISFLFRILPDTPQEPFALWEILNKNSDPLVGVILDNGGKTLTYFNYDQSGDFQTVTFEGPEIRKIFYGSFHKLHIVVSETLVKVVIDCKQVGEKAMNASANITSDGVEVLGKMVRSRGPGGNSAPFQLQMFDIVCST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rfc5 Mouse Gene Knockout Kit (CRISPR)
KN514692 1 Kit

Rfc5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Bpifa1 activation kit by CRISPRa
GA203298 1 Kit

Mouse Bpifa1 activation kit by CRISPRa

Sign In for Pricing
View Details
CD1 (CD1A) Mouse Monoclonal Antibody [Clone ID: C1A/711]
AM50210PU-S 100 µg

CD1 (CD1A) Mouse Monoclonal Antibody [Clone ID: C1A/711]

Sign In for Pricing
View Details
EGFRvIII (Epidermal Growth Factor Receptor, Variant III) (GFR/2600R), 0.2mg/mL
BNUB2600-100 1x 100 µL

EGFRvIII (Epidermal Growth Factor Receptor, Variant III) (GFR/2600R), 0.2mg/mL

Sign In for Pricing
View Details
WWOX Antibody
OC-867-01 50 μL

WWOX Antibody

Sign In for Pricing
View Details
WWOX Antibody
OC-867-02 100 µL

WWOX Antibody

Sign In for Pricing
View Details