Recombinant Human Sodium-dependent phosphate transport protein 2A (NPT2A), partial
This Recombinant Human Sodium-dependent phosphate transport protein 2A (NPT2A), partial spans the amino acid sequence from region 186-347. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Sodium-dependent phosphate transport protein 2A; Sodium-phosphate transport protein 2A; Na (+-dependent phosphate cotransporter 2A; NaPi-3; Sodium/phosphate cotransporter 2A; Na (+/Pi cotransporter 2A; NaPi-2a; Solute carrier family 34 member 1; SLC34A1 NPT2 SLC17A2
UniProt
Q06495
Expression Region
186-347
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
PIIMGSNIGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAATGYLHHITRLVVASFNIHGGRDAPDLLKIITEPFTKLIIQLDESVITSIATGDESLRNHSLIQIWCHPDSLQAPTSMSRAEANSSQTLGNATMEKCNHIFVDTGLPD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K7568908 1.0 µg DNA
Sertm1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
Sign In for Pricing
View Details