Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium channel regulatory subunit beta-1 (SCN1B), partial

This Recombinant Human Sodium channel regulatory subunit beta-1 (SCN1B), partial spans the amino acid sequence from region 19-157. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium channel regulatory subunit beta-1 SCN1B

UniProt

Q07699

Expression Region

19-157

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GGCVEVDSETEAVYGMTFKILCISCKRRSETNAETFTEWTFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIFITNVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD99 Mouse Monoclonal Antibody [Clone ID: UMLBI262]
AMM21995V 100 µL

CD99 Mouse Monoclonal Antibody [Clone ID: UMLBI262]

Sign In for Pricing
View Details
PMRT15
572689-01 50 µg

PMRT15

Sign In for Pricing
View Details
PMRT15
572689-02 100 µg

PMRT15

Sign In for Pricing
View Details
Anti-SOX5 Antibody Picoband® (HRP Conjugate)
PB9507-HRP 100 µg/Vial

Anti-SOX5 Antibody Picoband® (HRP Conjugate)

Sign In for Pricing
View Details
Lentiviral mouse Col5a3 shRNA (UAS) - Lentiviral mouse Col5a3 shRNA (UAS) (25)
GTR15132005 1 Vial

Lentiviral mouse Col5a3 shRNA (UAS) - Lentiviral mouse Col5a3 shRNA (UAS) (25)

Sign In for Pricing
View Details
Recombinant human HSP27 protein
ATGP0444-500 500 µg

Recombinant human HSP27 protein

Sign In for Pricing
View Details