Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Alpha-actinin-3 (ACTN3), partial

This Recombinant Human Alpha-actinin-3 (ACTN3), partial spans the amino acid sequence from region 158-264. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha-actinin-3; Alpha-actinin skeletal muscle isoform 3; F-actin cross-linking protein; ACTN3

UniProt

Q08043

Expression Region

158-264

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

TSAKEGLLLWCQRKTAPYRNVNVQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKYLDIPKMLDAEDIVNTPKPDEKAIMTYVSCFYHAFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACOX1
CSB-CL617998HU 10 μg Plasmid + 200 μL Glycerol

ACOX1

Sign In for Pricing
View Details
CASP1 Knockout Raji Polyclonal Cells
ARG42405 1 Million

CASP1 Knockout Raji Polyclonal Cells

Sign In for Pricing
View Details
Tff2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7049608 1.0 µg DNA

Tff2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
C2orf78 Protein Vector (Human) (pPB-N-His)
PV066534 500 ng

C2orf78 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
3-Ethoxy-3-oxo-2-phenylpropanoic acid
OR1046282-01 100 mg

3-Ethoxy-3-oxo-2-phenylpropanoic acid

Sign In for Pricing
View Details
3-Ethoxy-3-oxo-2-phenylpropanoic acid
OR1046282-02 250 mg

3-Ethoxy-3-oxo-2-phenylpropanoic acid

Sign In for Pricing
View Details