Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Alpha-actinin-3 (ACTN3), partial

This Recombinant Human Alpha-actinin-3 (ACTN3), partial spans the amino acid sequence from region 158-264. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha-actinin-3; Alpha-actinin skeletal muscle isoform 3; F-actin cross-linking protein; ACTN3

UniProt

Q08043

Expression Region

158-264

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

TSAKEGLLLWCQRKTAPYRNVNVQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKYLDIPKMLDAEDIVNTPKPDEKAIMTYVSCFYHAFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCD2 sgRNA CRISPR Lentivector (Human) (Target 1)
K0020902 1.0 µg DNA

ABCD2 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
MIRacle™ rno-miR-29a-5p miRNA Agomir/Antagomir
AM5107 2 OD, 4 OD, 50 OD

MIRacle™ rno-miR-29a-5p miRNA Agomir/Antagomir

Sign In for Pricing
View Details
CIT Protein Lysate (Rat) with C-HA Tag
16205036 100 µg

CIT Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Tmprss4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
47150114 3x 1.0 µg

Tmprss4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
cTnI Blocking Peptide
MBS8204539-01 1 mg

cTnI Blocking Peptide

Sign In for Pricing
View Details
cTnI Blocking Peptide
MBS8204539-02 5 mg

cTnI Blocking Peptide

Sign In for Pricing
View Details