Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitotic-spindle organizing protein 1 (MZT1)

This Recombinant Human Mitotic-spindle organizing protein 1 (MZT1) spans the amino acid sequence from region 2-82. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mitotic-spindle organizing protein 1; Mitotic-spindle organizing protein associated with a ring of gamma-tubulin 1; MZT1 C13orf37 MOZART1

UniProt

Q08AG7

Expression Region

2-82

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ASSSGAGAAAAAAAANLNAVRETMDVLLEISRILNTGLDMETLSICVRLCEQGINPEALSSVIKELRKATEALKAAENMTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Desmuslin Rabbit Polyclonal Antibody (Cy5)
orb873559 100 µL

Desmuslin Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Mouse MAGEE1 siRNA
abx923322-01 15 nmol

Mouse MAGEE1 siRNA

Sign In for Pricing
View Details
Mouse MAGEE1 siRNA
abx923322-02 30 nmol

Mouse MAGEE1 siRNA

Sign In for Pricing
View Details
LysRS shRNA (h) Lentiviral Particles
sc-75718-V 200 µL

LysRS shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Anti-HuC/HuD protein Rabbit pAb
GB113756-100 100 μL

Anti-HuC/HuD protein Rabbit pAb

Sign In for Pricing
View Details
Rabbit Factor Xa
orb2942731-01 10 mg

Rabbit Factor Xa

Sign In for Pricing
View Details