Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Voltage-gated inwardly rectifying potassium channel KCNH2 (KCNH2), partial

This Recombinant Human Voltage-gated inwardly rectifying potassium channel KCNH2 (KCNH2), partial spans the amino acid sequence from region 569-611. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Voltage-gated inwardly rectifying potassium channel KCNH2; Eag homolog; Ether-a-go-go-related gene potassium channel 1; ERG-1; Eag-related protein 1; Ether-a-go-go-related protein 1; H-ERG; hERG-1; hERG1; Potassium voltage-gated channel subfamily H member 2; Voltage-gated potassium channel subunit Kv11.1; KCNH2 ERG ERG1 HERG

UniProt

Q12809

Expression Region

569-611

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YAIGNMEQPHMDSRIGWLHNLGDQIGKPYNSSGLGGPSIKDKY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UGT1A5 Adenovirus (Human)
49116051 1.0 mL

UGT1A5 Adenovirus (Human)

Sign In for Pricing
View Details
Recombinant Human E3 ubiquitin-protein ligase TRIM9
MBS9421443-01 0.02 mg

Recombinant Human E3 ubiquitin-protein ligase TRIM9

Sign In for Pricing
View Details
Recombinant Human E3 ubiquitin-protein ligase TRIM9
MBS9421443-02 0.1 mg

Recombinant Human E3 ubiquitin-protein ligase TRIM9

Sign In for Pricing
View Details
Recombinant Human E3 ubiquitin-protein ligase TRIM9
MBS9421443-03 1 mg

Recombinant Human E3 ubiquitin-protein ligase TRIM9

Sign In for Pricing
View Details
Recombinant Human E3 ubiquitin-protein ligase TRIM9
MBS9421443-04 5x 1 mg

Recombinant Human E3 ubiquitin-protein ligase TRIM9

Sign In for Pricing
View Details
DUSP15 Polyclonal Antibody
E916322 100 µL

DUSP15 Polyclonal Antibody

Sign In for Pricing
View Details