Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Shieldin complex subunit 3 (SHLD3)

This Recombinant Human Shieldin complex subunit 3 (SHLD3) spans the amino acid sequence from region 1-250. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Shieldin complex subunit 3; REV7-interacting novel NHEJ regulator 1; Shield complex subunit 3; SHLD3 FLJ26957 RINN1

UniProt

Q6ZNX1

Expression Region

1-250

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTTEVILHYRPCESDPTQLPKIAEKAIQDFPTRPLSRFIPWFPYDGSKLPLRPKRSPPVISEEAAEDVKQYLTISEHDAKSHSYDCTVDLLEFQPSLKKQHLTWSHTLKEQTNSGNLGKQSEKGKQHKRRSWSISLPSNNCTKNVSPLSKKLQDSLKALNLHSLYRARWTIEHTICNSQTLEDIWTKLNQIIRHNELPSCNATIQRHLGQIWVFCDIMYCEYVGSLLKGRLALTGKINLFVHKYGVIFSM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-HSP90 alpha Antibody
YLD4156-01 50 µL

Rabbit anti-HSP90 alpha Antibody

Sign In for Pricing
View Details
Rabbit anti-HSP90 alpha Antibody
YLD4156-02 100 µL

Rabbit anti-HSP90 alpha Antibody

Sign In for Pricing
View Details
Guinea Pig Desacyl Ghrelin ELISA kit
GTR10444724 96 Well

Guinea Pig Desacyl Ghrelin ELISA kit

Sign In for Pricing
View Details
TRAPPC4 Mouse Monoclonal Antibody [Clone:4C3]
E45M13301 100 µg

TRAPPC4 Mouse Monoclonal Antibody [Clone:4C3]

Sign In for Pricing
View Details
Platelet Derived Growth Factor BB (PDGF-BB, Platelet-derived Growth Factor B Chain, Platelet-derived Growth Factor beta, Platelet-derived Growth Factor beta Polypeptide, PDGFB, PDGF-B, PDGF-B Chain, Becaplermin, C-sis, FLJ12858, Oncogene SIS, PDGFB/COL1A1 Fusion Gene, Platelet-derived Growth Factor 2, PDGF2, PDGF-2, Simian Sarcoma Viral (v-sis) Oncogene Homolog, SSV, SIS, V-sis Platelet-derived Growth Factor beta Polypeptide) (MaxLight 650) discontinued
P4258-17G-ML650 100 µL

Platelet Derived Growth Factor BB (PDGF-BB, Platelet-derived Growth Factor B Chain, Platelet-derived Growth Factor beta, Platelet-derived Growth Factor beta Polypeptide, PDGFB, PDGF-B, PDGF-B Chain, Becaplermin, C-sis, FLJ12858, Oncogene SIS, PDGFB/COL1A1 Fusion Gene, Platelet-derived Growth Factor 2, PDGF2, PDGF-2, Simian Sarcoma Viral (v-sis) Oncogene Homolog, SSV, SIS, V-sis Platelet-derived Growth Factor beta Polypeptide) (MaxLight 650) discontinued

Sign In for Pricing
View Details
SAE1, CT (SUMO-activating Enzyme Subunit 1, Ubiquitin-like 1-activating Enzyme E1A, AOS1, SUA1, UBLE1A) (AP) discontinued
S8025-85L-AP 200 µL

SAE1, CT (SUMO-activating Enzyme Subunit 1, Ubiquitin-like 1-activating Enzyme E1A, AOS1, SUA1, UBLE1A) (AP) discontinued

Sign In for Pricing
View Details