Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Shieldin complex subunit 3 (SHLD3)

This Recombinant Human Shieldin complex subunit 3 (SHLD3) spans the amino acid sequence from region 1-250. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Shieldin complex subunit 3; REV7-interacting novel NHEJ regulator 1; Shield complex subunit 3; SHLD3 FLJ26957 RINN1

UniProt

Q6ZNX1

Expression Region

1-250

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTTEVILHYRPCESDPTQLPKIAEKAIQDFPTRPLSRFIPWFPYDGSKLPLRPKRSPPVISEEAAEDVKQYLTISEHDAKSHSYDCTVDLLEFQPSLKKQHLTWSHTLKEQTNSGNLGKQSEKGKQHKRRSWSISLPSNNCTKNVSPLSKKLQDSLKALNLHSLYRARWTIEHTICNSQTLEDIWTKLNQIIRHNELPSCNATIQRHLGQIWVFCDIMYCEYVGSLLKGRLALTGKINLFVHKYGVIFSM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Culture Medium for Mouse Renal Tubular Epithelial Cells [TCMK-1]
AFG-ELL-3150-01 125 mL

Culture Medium for Mouse Renal Tubular Epithelial Cells [TCMK-1]

Sign In for Pricing
View Details
Culture Medium for Mouse Renal Tubular Epithelial Cells [TCMK-1]
AFG-ELL-3150-02 500 mL

Culture Medium for Mouse Renal Tubular Epithelial Cells [TCMK-1]

Sign In for Pricing
View Details
Mouse Ptp4a1 Pre-designed siRNA Set B
SI111411B 1 Each

Mouse Ptp4a1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Cytochrome P450 1A2 Antibody
MBS9505733-01 0.05 mL

Cytochrome P450 1A2 Antibody

Sign In for Pricing
View Details
Cytochrome P450 1A2 Antibody
MBS9505733-02 0.1 mL

Cytochrome P450 1A2 Antibody

Sign In for Pricing
View Details
Cytochrome P450 1A2 Antibody
MBS9505733-03 5x 0.1 mL

Cytochrome P450 1A2 Antibody

Sign In for Pricing
View Details