Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bcl-2-binding component 3, isoforms 3/4 (BBC3B)

This Recombinant Human Bcl-2-binding component 3, isoforms 3/4 (BBC3B) spans the amino acid sequence from region 1-261. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bcl-2-binding component 3, isoforms 3/4; JFY-1; p53 up-regulated modulator of apoptosis; BBC3 PUMA

UniProt

Q96PG8

Expression Region

1-261

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MKFGMGSAQACPCQVPRAASTTWVPCQICGPRERHGPRTPGGQLPGARRGPGPRRPAPLPARPPGALGSVLRPLRARPGCRPRRPHPAARCLPLRPHRPTRRHRRPGGFPLAWGSPQPAPRPAPGRSSALALAGGAAPGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADGGRPQRTVRAAETRGAAAAPPLTLEGPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDSGGRPLPPPDTLASAGDFLCTM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AS1842856
B8219-5 5 mg

AS1842856

Sign In for Pricing
View Details
Bovine Lymphocyte Function Associated Antigen 3 (LFA-3) ELISA Kit
MBS2609424-01 48 Well

Bovine Lymphocyte Function Associated Antigen 3 (LFA-3) ELISA Kit

Sign In for Pricing
View Details
Bovine Lymphocyte Function Associated Antigen 3 (LFA-3) ELISA Kit
MBS2609424-02 96 Well

Bovine Lymphocyte Function Associated Antigen 3 (LFA-3) ELISA Kit

Sign In for Pricing
View Details
Bovine Lymphocyte Function Associated Antigen 3 (LFA-3) ELISA Kit
MBS2609424-03 5x 96 Well

Bovine Lymphocyte Function Associated Antigen 3 (LFA-3) ELISA Kit

Sign In for Pricing
View Details
Bovine Lymphocyte Function Associated Antigen 3 (LFA-3) ELISA Kit
MBS2609424-04 10x 96 Well

Bovine Lymphocyte Function Associated Antigen 3 (LFA-3) ELISA Kit

Sign In for Pricing
View Details
Npy2r Rat shRNA Plasmid (Locus ID 66024)
TL710941 1 Kit

Npy2r Rat shRNA Plasmid (Locus ID 66024)

Sign In for Pricing
View Details