Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Synaptotagmin-3 (SYT3), partial

This Recombinant Human Synaptotagmin-3 (SYT3), partial spans the amino acid sequence from region 76-590. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Synaptotagmin-3; Synaptotagmin III; SytIII; SYT3

UniProt

Q9BQG1

Expression Region

76-590

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

WKLCWVPWRDKGGSAVGGGPLRKDLGPGVGLAGLVGGGGHHLAAGLGGHPLLGGPHHHAHAAHHPPFAELLEPGSLGGSDTPEPSYLDMDSYPEAAAAAVAAGVKPSQTSPELPSEGGAGSGLLLLPPSGGGLPSAQSHQQVTSLAPTTRYPALPRPLTQQTLTSQPDPSSEERPPALPLPLPGGEEKAKLIGQIKPELYQGTGPGGRRSGGGPGSGEAGTGAPCGRISFALRYLYGSDQLVVRILQALDLPAKDSNGFSDPYVKIYLLPDRKKKFQTKVHRKTLNPVFNETFQFSVPLAELAQRKLHFSVYDFDRFSRHDLIGQVVLDNLLELAEQPPDRPLWRDIVEGGSEKADLGELNFSLCYLPTAGRLTVTIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVAPESVENVGLSIAVVDYDCIGHNEVIGVCRVGPDAADPHGREHWAEMLANPRKPVEHWHQLVEEKTVTSFTKGSKGLSEKENSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IPO7 Antibody
orb254004 100 µL

IPO7 Antibody

Sign In for Pricing
View Details
B3GALNT1 Protein Vector (Mouse) (pPB-C-His)
PV157962 500 ng

B3GALNT1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Human Pbx3 Protein - (Dry Ice)
H00005090-Q01-25ug 25 µg

Recombinant Human Pbx3 Protein - (Dry Ice)

Sign In for Pricing
View Details
Fascin 2 (G-12) Alexa Fluor® 594
sc-515233 AF594 200 µg/mL

Fascin 2 (G-12) Alexa Fluor® 594

Sign In for Pricing
View Details
Rabbit Glutathione S Transferases ELISA Kit
MBS730822-01 48 Well

Rabbit Glutathione S Transferases ELISA Kit

Sign In for Pricing
View Details
Rabbit Glutathione S Transferases ELISA Kit
MBS730822-02 96 Well

Rabbit Glutathione S Transferases ELISA Kit

Sign In for Pricing
View Details