Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Allograft inflammatory factor 1-like (AIF1L)

This Recombinant Human Allograft inflammatory factor 1-like (AIF1L) spans the amino acid sequence from region 2-150. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allograft inflammatory factor 1-like; Ionized calcium-binding adapter molecule 2; AIF1L C9orf58 IBA2 UNQ672/PRO1306

UniProt

Q9BQI0

Expression Region

2-150

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SGELSNRFQGGKAFGLLKARQERRLAEINREFLCDQKYSDEENLPEKLTAFKEKYMEFDLNNEGEIDLMSLKRMMEKLGVPKTHLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPVGPPPERDIASLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD86 (Dendritic Cells Maturation Marker) (rC86/1146), Biotin conjugate, 0.1mg/mL
BNCB2083-100 1x 100 µL

CD86 (Dendritic Cells Maturation Marker) (rC86/1146), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3,4-Dihydroxybenzyl Alcohol
TRC-D493205-500MG 500 mg

3,4-Dihydroxybenzyl Alcohol

Sign In for Pricing
View Details
Tissue FFPE Sections, Myometrium
CS700144 5x 5 µm

Tissue FFPE Sections, Myometrium

Sign In for Pricing
View Details
Mouse PD-1 / PDCD1 Protein, Mouse IgG2a Fc Tag (MALS verified)
PD1-M5257-100ug 100 µg

Mouse PD-1 / PDCD1 Protein, Mouse IgG2a Fc Tag (MALS verified)

Sign In for Pricing
View Details
HSPA4 Recombinant Rabbit Monoclonal Antibody [SD0861]
ET1612-83 100 µL

HSPA4 Recombinant Rabbit Monoclonal Antibody [SD0861]

Sign In for Pricing
View Details
4-Chloro-1-napthalenecarboxylic Acid
TRC-C370940-2.5G 2.5 g

4-Chloro-1-napthalenecarboxylic Acid

Sign In for Pricing
View Details