Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neuronal-specific septin-3 (SEPT3)

This Recombinant Human Neuronal-specific septin-3 (SEPT3) spans the amino acid sequence from region 1-358. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Neuronal-specific septin-3 SEPTIN3 SEP3 SEPT3

UniProt

Q9UH03

Expression Region

1-358

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSKGLPETRTDAAMSELVPEPRPKPAVPMKPMSINSNLLGYIGIDTIIEQMRKKTMKTGFDFNIMVVGQSGLGKSTLVNTLFKSQVSRKASSWNREEKIPKTVEIKAIGHVIEEGGVKMKLTVIDTPGFGDQINNENCWEPIEKYINEQYEKFLKEEVNIARKKRIPDTRVHCCLYFISPTGHSLRPLDLEFMKHLSKVVNIIPVIAKADTMTLEEKSEFKQRVRKELEVNGIEFYPQKEFDEDLEDKTENDKIRQESMPFAVVGSDKEYQVNGKRVLGRKTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPGEGLLGTVLPPVPATPCPTAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLDN1 Conjugated Antibody
C31203 100 µL

CLDN1 Conjugated Antibody

Sign In for Pricing
View Details
Anti-p57 Kip2 Antibody
CPA9705-01 30 µL

Anti-p57 Kip2 Antibody

Sign In for Pricing
View Details
Anti-p57 Kip2 Antibody
CPA9705-02 50 μL

Anti-p57 Kip2 Antibody

Sign In for Pricing
View Details
Anti-p57 Kip2 Antibody
CPA9705-03 100 µL

Anti-p57 Kip2 Antibody

Sign In for Pricing
View Details
Anti-p57 Kip2 Antibody
CPA9705-04 200 µL

Anti-p57 Kip2 Antibody

Sign In for Pricing
View Details
PCDHB15 antibody
70R-4495 50 ug

PCDHB15 antibody

Sign In for Pricing
View Details