Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neuronal-specific septin-3 (SEPT3)

This Recombinant Human Neuronal-specific septin-3 (SEPT3) spans the amino acid sequence from region 1-358. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Neuronal-specific septin-3 SEPTIN3 SEP3 SEPT3

UniProt

Q9UH03

Expression Region

1-358

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSKGLPETRTDAAMSELVPEPRPKPAVPMKPMSINSNLLGYIGIDTIIEQMRKKTMKTGFDFNIMVVGQSGLGKSTLVNTLFKSQVSRKASSWNREEKIPKTVEIKAIGHVIEEGGVKMKLTVIDTPGFGDQINNENCWEPIEKYINEQYEKFLKEEVNIARKKRIPDTRVHCCLYFISPTGHSLRPLDLEFMKHLSKVVNIIPVIAKADTMTLEEKSEFKQRVRKELEVNGIEFYPQKEFDEDLEDKTENDKIRQESMPFAVVGSDKEYQVNGKRVLGRKTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPGEGLLGTVLPPVPATPCPTAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse B29 Differentiation Reporter (pGreenZeo, Plasmid)
SR1005PA-1 10 µg

Mouse B29 Differentiation Reporter (pGreenZeo, Plasmid)

Sign In for Pricing
View Details
Magic™ Antibody Discovery - Cynomolgus PSMA / FOLH1 (44-750) Membrane Protein, PaRoom Temperatureial, His- tag
MP0795F Each

Magic™ Antibody Discovery - Cynomolgus PSMA / FOLH1 (44-750) Membrane Protein, PaRoom Temperatureial, His- tag

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Alanine--tRNA ligase (alaS), partial
MBS1412200 Inquire

Recombinant Staphylococcus aureus Alanine--tRNA ligase (alaS), partial

Sign In for Pricing
View Details
Rabbit Polyclonal Contactin-2/TAG1 Antibody [DyLight 594]
NBP2-99312DL594 0.1 mL

Rabbit Polyclonal Contactin-2/TAG1 Antibody [DyLight 594]

Sign In for Pricing
View Details
Nup98 3'UTR Luciferase Stable Cell Line
TU214310 1.0 mL

Nup98 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Ubr2 3'UTR Luciferase Stable Cell Line
TU222791 1.0 mL

Ubr2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details