Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human General transcription factor II-I repeat domain-containing protein 1 (GT2D1), partial

This Recombinant Human General transcription factor II-I repeat domain-containing protein 1 (GT2D1), partial spans the amino acid sequence from region 565-650. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

General transcription factor II-I repeat domain-containing protein 1; GTF2I repeat domain-containing protein 1; General transcription factor III; MusTRD1/BEN; Muscle TFII-I repeat domain-containing protein 1; Slow-muscle-fiber enhancer-binding protein; USE B1-binding protein; Williams-Beuren syndrome chromosomal region 11 protein; Williams-Beuren syndrome chromosomal region 12 protein; GTF2IRD1 CREAM1 GTF3 MUSTRD1 RBAP2 WBSCR11 WBSCR12

UniProt

Q9UHL9

Expression Region

565-650

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LRKQVELLFNTRYAKAIGISEPVKVPYSKFLMHPEELFVVGLPEGISLRRPNCFGIAKLRKILEASNSIQFVIKRPELLTEGVKEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTDSPL2 Antibody
KC-43619-01 50 μL

CTDSPL2 Antibody

Sign In for Pricing
View Details
CTDSPL2 Antibody
KC-43619-02 100 µL

CTDSPL2 Antibody

Sign In for Pricing
View Details
CTDSPL2 Antibody
KC-43619-03 1 mL

CTDSPL2 Antibody

Sign In for Pricing
View Details
Human DPP10 activation kit by CRISPRa
GA111645 1 Kit

Human DPP10 activation kit by CRISPRa

Sign In for Pricing
View Details
Tyrosinase (TYR) (NM_000372) Human Recombinant Protein
TP321797M 100 µg

Tyrosinase (TYR) (NM_000372) Human Recombinant Protein

Sign In for Pricing
View Details
IL 12 Rat
OM296744-01 10 µg

IL 12 Rat

Sign In for Pricing
View Details