Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein jagged-2 (JAG2), partial

This Recombinant Human Protein jagged-2 (JAG2), partial spans the amino acid sequence from region 870-944. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein jagged-2; Jagged2; hJ2; JAG2

UniProt

Q9Y219

Expression Region

870-944

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RSCWSRGTPFPHGSSWVEDCNSCRCLDGRRDCSKVWCGWKPCLLAGQPEALSAQCPLGQRCLEKAPGQCLRPPCE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Crystal Violet
B1920-50 50 mg

Crystal Violet

Sign In for Pricing
View Details
HRSP12 Polyclonal Antibody, FITC Conjugated
A62752-100 100 µL

HRSP12 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
LRRC28 Peptide - N-terminal region (AAP52690)
AAP52690-100UG 100 µg

LRRC28 Peptide - N-terminal region (AAP52690)

Sign In for Pricing
View Details
Research Grade Ralpancizumab
HV275066-01 100 µg

Research Grade Ralpancizumab

Sign In for Pricing
View Details
Research Grade Ralpancizumab
HV275066-02 1 mg

Research Grade Ralpancizumab

Sign In for Pricing
View Details
DHRS2 (NM_182908) Human Tagged ORF Clone
RG201102 10 µg

DHRS2 (NM_182908) Human Tagged ORF Clone

Sign In for Pricing
View Details