Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium-dependent multivitamin transporter (SC5A6), partial

This Recombinant Human Sodium-dependent multivitamin transporter (SC5A6), partial spans the amino acid sequence from region 549-635. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium-dependent multivitamin transporter; Na (+-dependent multivitamin transporter; hSMVT; Solute carrier family 5 member 6; SLC5A6 SMVT

UniProt

Q9Y289

Expression Region

549-635

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

TGRMRGRSLNPATIYPVLPKLLSLLPLSCQKRLHCRSYGQDHLDTGLFPEKPRNGVLGDSRDKEAMALDGTAYQGSSSTCILQETSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pOTB7-IFI6 Plasmid
PVT25480 2 µg

pOTB7-IFI6 Plasmid

Sign In for Pricing
View Details
FXN Peptide
DF6590-BP 1 mg

FXN Peptide

Sign In for Pricing
View Details
Ly1 Antibody Reactive Homolog (LYAR) Polyclonal Antibody
CAU21089-01 100 µL

Ly1 Antibody Reactive Homolog (LYAR) Polyclonal Antibody

Sign In for Pricing
View Details
Ly1 Antibody Reactive Homolog (LYAR) Polyclonal Antibody
CAU21089-02 200 µL

Ly1 Antibody Reactive Homolog (LYAR) Polyclonal Antibody

Sign In for Pricing
View Details
Ly1 Antibody Reactive Homolog (LYAR) Polyclonal Antibody
CAU21089-03 1 mL

Ly1 Antibody Reactive Homolog (LYAR) Polyclonal Antibody

Sign In for Pricing
View Details
TLK2 (17Z19) Mouse Monoclonal antibody
E28PE3163 100 µL

TLK2 (17Z19) Mouse Monoclonal antibody

Sign In for Pricing
View Details