Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium-dependent multivitamin transporter (SC5A6), partial

This Recombinant Human Sodium-dependent multivitamin transporter (SC5A6), partial spans the amino acid sequence from region 549-635. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium-dependent multivitamin transporter; Na (+-dependent multivitamin transporter; hSMVT; Solute carrier family 5 member 6; SLC5A6 SMVT

UniProt

Q9Y289

Expression Region

549-635

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

TGRMRGRSLNPATIYPVLPKLLSLLPLSCQKRLHCRSYGQDHLDTGLFPEKPRNGVLGDSRDKEAMALDGTAYQGSSSTCILQETSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLCL2 siRNA (Human)
MBS8214536-01 15 nmol

PLCL2 siRNA (Human)

Sign In for Pricing
View Details
PLCL2 siRNA (Human)
MBS8214536-02 30 nmol

PLCL2 siRNA (Human)

Sign In for Pricing
View Details
PLCL2 siRNA (Human)
MBS8214536-03 5x 30 nmol

PLCL2 siRNA (Human)

Sign In for Pricing
View Details
OSR1 (h) -PR
sc-62721-PR 10 µM - 20 µL

OSR1 (h) -PR

Sign In for Pricing
View Details
CD2 Mouse Monoclonal Antibody [Clone 1C5]
E45M14735V-2 50 µL

CD2 Mouse Monoclonal Antibody [Clone 1C5]

Sign In for Pricing
View Details
C22orf29 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-15135R-BF555 100 µL

C22orf29 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details