Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fanconi-associated nuclease 1 (FAN1), partial

This Recombinant Human Fanconi-associated nuclease 1 (FAN1), partial spans the amino acid sequence from region 895-1007. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fanconi-associated nuclease 1; EC 3.1.21.-; EC 3.1.4.1; FANCD2/FANCI-associated nuclease 1; hFAN1; Myotubularin-related protein 15; FAN1 KIAA1018 MTMR15

UniProt

Q9Y2M0

Expression Region

895-1007

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EESLRAWVAATWHEQEGRVASLVSWDRFTSLQQAQDLVSCLGGPVLSGVCRHLAADFRHCRGGLPDLVVWNSQSRHFKLVEVKGPNDRLSHKQMIWLAELQKLGAEVEVCHVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-human P4HA2 polyclonal Antibody
MBS1495150-01 0.05 mL

Rabbit anti-human P4HA2 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human P4HA2 polyclonal Antibody
MBS1495150-02 0.1 mL

Rabbit anti-human P4HA2 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human P4HA2 polyclonal Antibody
MBS1495150-03 5x 0.1 mL

Rabbit anti-human P4HA2 polyclonal Antibody

Sign In for Pricing
View Details
Sort1 (NM_019972) Mouse Tagged ORF Clone
MG210834 10 µg

Sort1 (NM_019972) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Anti-Human LRAT (031) Rabbit IgG
30116228 5 µg

Anti-Human LRAT (031) Rabbit IgG

Sign In for Pricing
View Details
UMOD, ID (UMOD, Uromodulin, Tamm-Horsfall urinary glycoprotein, Uromodulin, secreted form) (MaxLight 490)
MBS6361427-01 0.1 mL

UMOD, ID (UMOD, Uromodulin, Tamm-Horsfall urinary glycoprotein, Uromodulin, secreted form) (MaxLight 490)

Sign In for Pricing
View Details