Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human U6 snRNA-associated Sm-like protein LSm2 (LSM2)

This Recombinant Human U6 snRNA-associated Sm-like protein LSm2 (LSM2) spans the amino acid sequence from region 1-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

U6 snRNA-associated Sm-like protein LSm2; Protein G7b; Small nuclear ribonuclear protein D homolog; snRNP core Sm-like protein Sm-x5; LSM2 C6orf28 G7B

UniProt

Q9Y333

Expression Region

1-95

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM120C Rabbit pAb
E47R6810 100 µL

FAM120C Rabbit pAb

Sign In for Pricing
View Details
Rabbit IgG (H+L) Antibody : Biotin
OASB02872-500UG 0.5 mg

Rabbit IgG (H+L) Antibody : Biotin

Sign In for Pricing
View Details
5-Chlorouracil 98%
C20240-01 5 g

5-Chlorouracil 98%

Sign In for Pricing
View Details
5-Chlorouracil 98%
C20240-02 25 g

5-Chlorouracil 98%

Sign In for Pricing
View Details
EGR1 (Early Growth Response Protein 1) BioAssayTM ELISA Kit (Mouse) discontinued
355403-01 48 Tests

EGR1 (Early Growth Response Protein 1) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
EGR1 (Early Growth Response Protein 1) BioAssayTM ELISA Kit (Mouse) discontinued
355403-02 96 Tests

EGR1 (Early Growth Response Protein 1) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details