Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial fission 1 protein (FIS1), partial

This Recombinant Human Mitochondrial fission 1 protein (FIS1), partial spans the amino acid sequence from region 1-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mitochondrial fission 1 protein; FIS1 homolog; hFis1; Tetratricopeptide repeat protein 11; TPR repeat protein 11; FIS1 TTC11 CGI-135

UniProt

Q9Y3D6

Expression Region

1-122

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF594 conjugate, 0.1mg/mL
BNC940333-500 1x 500 µL

CD8 (RIV11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL
BNC681003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL
TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL
BNC680977-100 1x 100 µL

TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL
BNC740043-100 1x 100 µL

P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF647 conjugate, 0.1mg/mL
BNC471035-100 1x 100 µL

CD8 (C8/1035), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details