Recombinant Human Mitochondrial fission 1 protein (FIS1), partial
This Recombinant Human Mitochondrial fission 1 protein (FIS1), partial spans the amino acid sequence from region 1-122. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Mitochondrial fission 1 protein; FIS1 homolog; hFis1; Tetratricopeptide repeat protein 11; TPR repeat protein 11; FIS1 TTC11 CGI-135
UniProt
Q9Y3D6
Expression Region
1-122
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal MIER2 Antibody (OTI3G7) [CoraFluor 1]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
NBP2-72683CL1 0.1 mL
Mouse Monoclonal MIER2 Antibody (OTI3G7) [CoraFluor 1]
Sign In for Pricing
View Details 
#20350-1 1x 50 µL
CF®350 Donkey Anti-Mouse IgG (H+L), Highly Cross-Adsorbed, 2 mg/mL
Sign In for Pricing
View Details 
N004329 2 Card (2 Marker (s) x 1 Card)
HOOGOVENGAS450X52CARD-T1-P2 Pipe Markers for Gases
Sign In for Pricing
View Details