Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1/HMG-1, Human (HEK293, C-His)

The multifunctional and redox-sensitive HMGB1/HMG-1 protein plays multiple roles in cellular compartments. In the nucleus, it serves as a major chromatin-associated non-histone protein involved in key processes such as replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair, and genome stability. HMGB1/HMG-1 Protein, Human (HEK293, His) is the recombinant human-derived HMGB1/HMG-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

HMGB1/HMG-1 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hmgb1-hmg-1-protein-human-hek293-c-his.html

Purity

95.00

Smiles

GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Molecular Formula

3146 (Gene_ID) P09429 (G2-E215) (Accession)

Molecular Weight

Approximately 24-33 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal DOK2 Antibody (OTI1A4) [FITC]
NBP2-71407F 0.1 mL

Mouse Monoclonal DOK2 Antibody (OTI1A4) [FITC]

Sign In for Pricing
View Details
IR (Phospho-Tyr1361) Antibody
MBS9409771-01 0.05 mL

IR (Phospho-Tyr1361) Antibody

Sign In for Pricing
View Details
IR (Phospho-Tyr1361) Antibody
MBS9409771-02 0.1 mL

IR (Phospho-Tyr1361) Antibody

Sign In for Pricing
View Details
IR (Phospho-Tyr1361) Antibody
MBS9409771-03 5x 0.1 mL

IR (Phospho-Tyr1361) Antibody

Sign In for Pricing
View Details
Guanosine triphosphate-13C10 (dilithium)
HY-113225S5 1 mg (100 mM in 18.35 μL Tris HCl/H2O buffer pH=7.5)

Guanosine triphosphate-13C10 (dilithium)

Sign In for Pricing
View Details
GDPD1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV680184 1.0 µg DNA

GDPD1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details