Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable RNA-binding protein 19 (RBM19), partial

This Recombinant Human Probable RNA-binding protein 19 (RBM19), partial spans the amino acid sequence from region 730-811. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable RNA-binding protein 19; RNA-binding motif protein 19; RBM19 KIAA0682

UniProt

Q9Y4C8

Expression Region

730-811

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CTLFIKNLNFDTTEEKLKEVFSKVGTVKSCSISKKKNKAGVLLSMGFGFVEYRKPEQAQKALKQLQGHVVDGHKLEVRISER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC38A6 Protein Vector (Rat) (pPM-C-HA)
44173026 500 ng

SLC38A6 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Oridonin
SM5152-25mg 25 mg

Oridonin

Sign In for Pricing
View Details
DEN2D rabbit pAb
RA24173-01 50 µL

DEN2D rabbit pAb

Sign In for Pricing
View Details
DEN2D rabbit pAb
RA24173-02 100 µL

DEN2D rabbit pAb

Sign In for Pricing
View Details
Mouse Exoc3l4 Pre-designed siRNA Set B
SI104506B 1 Each

Mouse Exoc3l4 Pre-designed siRNA Set B

Sign In for Pricing
View Details
C330003B14RIK antibody
20R-1169 100 ug

C330003B14RIK antibody

Sign In for Pricing
View Details