Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human U6 snRNA-associated Sm-like protein LSm5 (LSM5)

This Recombinant Human U6 snRNA-associated Sm-like protein LSm5 (LSM5) spans the amino acid sequence from region 2-91. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

U6 snRNA-associated Sm-like protein LSm5 LSM5

UniProt

Q9Y4Y9

Expression Region

2-91

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EFEMP2 Antibody - middle region : FITC (ARP55351_P050-FITC)
ARP55351_P050-FITC 100 µL

EFEMP2 Antibody - middle region : FITC (ARP55351_P050-FITC)

Sign In for Pricing
View Details
31 Antibody
orb835416 2 mg

31 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal KIF2C Antibody (KIF2C/6526) [DyLight 550]
NBP3-21102R 0.1 mL

Mouse Monoclonal KIF2C Antibody (KIF2C/6526) [DyLight 550]

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Uncharacterized lipoprotein SAV0441 (lpl5)
MBS1430772-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus Uncharacterized lipoprotein SAV0441 (lpl5)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Uncharacterized lipoprotein SAV0441 (lpl5)
MBS1430772-02 0.1 mg (E-Coli)

Recombinant Staphylococcus aureus Uncharacterized lipoprotein SAV0441 (lpl5)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Uncharacterized lipoprotein SAV0441 (lpl5)
MBS1430772-03 0.02 mg (Yeast)

Recombinant Staphylococcus aureus Uncharacterized lipoprotein SAV0441 (lpl5)

Sign In for Pricing
View Details