Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Choline-phosphate cytidylyltransferase B (PCY1B)

This Recombinant Human Choline-phosphate cytidylyltransferase B (PCY1B) spans the amino acid sequence from region 1-369. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Choline-phosphate cytidylyltransferase B; EC 2.7.7.15; CCT-beta; CTP:phosphocholine cytidylyltransferase B; CCT B; CT B; Phosphorylcholine transferase B; PCYT1B CCTB

UniProt

Q9Y5K3

Expression Region

1-369

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRLTLTAPAPFADETNCQCQAPHEKLTIAQARLGTPADRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHKFKGFTVMNEAERYEALRHCRYVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKRYRFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEEKSREFIGNFLELFGPDGAWKQMFQERSSRMLQALSPKQSPVSSPTRSRSPSRSPSPTFSWLPLKTSPPSSPKAASASISSMSEGDEDEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Armcx2 (NM_001014274) Rat Tagged Lenti ORF Clone
RR203967L3 10 µg

Armcx2 (NM_001014274) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rat Stromal Cell Derived Factor 1 (SDF1) ELISA Kit
EKL61928 96 Tests

Rat Stromal Cell Derived Factor 1 (SDF1) ELISA Kit

Sign In for Pricing
View Details
ACER1 3'UTR GFP Stable Cell Line
TU050158 1.0 mL

ACER1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PITRM1 Antibody - middle region
ARP83290_P050-25UL 25 µL

PITRM1 Antibody - middle region

Sign In for Pricing
View Details
EGFR Protein (N-GST, Human)
P524203 100 µg

EGFR Protein (N-GST, Human)

Sign In for Pricing
View Details
Lynx1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6405106 1.0 µg DNA

Lynx1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details