Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human DnaJ homolog subfamily C member 15 (DJC15), partial

This Recombinant Human DnaJ homolog subfamily C member 15 (DJC15), partial spans the amino acid sequence from region 59-150. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DnaJ homolog subfamily C member 15; Cell growth-inhibiting gene 22 protein; Methylation-controlled J protein; MCJ; DNAJC15 DNAJD1 GIG22 HSD18

UniProt

Q9Y5T4

Expression Region

59-150

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RIWKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF488A conjugate, 0.1mg/mL
BNC880871-500 1x 500 µL

CD71 (66IG10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF740 conjugate, 0.1mg/mL
BNC740152-500 1x 500 µL

CD11c (HC1/1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nucleolin (NCL/902), CF594 conjugate, 0.1mg/mL
BNC940902-100 1x 100 µL

Nucleolin (NCL/902), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (BCL2/782 + BCL2/796), CF740 conjugate, 0.1mg/mL
BNC741023-100 1x 100 µL

Bcl-2 (BCL2/782 + BCL2/796), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GLG1 (Golgi Complex) (GLG1/970), CF594 conjugate, 0.1mg/mL
BNC940970-500 1x 500 µL

GLG1 (Golgi Complex) (GLG1/970), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
WIPI2 (2A2), CF594 conjugate, 0.1mg/mL
BNC942904-100 1x 100 µL

WIPI2 (2A2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details