Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial pyruvate carrier 1 (MPC1), partial

This Recombinant Human Mitochondrial pyruvate carrier 1 (MPC1), partial spans the amino acid sequence from region 72-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mitochondrial pyruvate carrier 1; Brain protein 44-like protein; MPC1 BRP44L CGI-129 HSPC040 PNAS-115

UniProt

Q9Y5U8

Expression Region

72-109

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KVQPRNWLLFACHATNEVAQLIQGGRLIKHEMTKTASA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ECD
CSB-CL007370HU 10 μg Plasmid + 200 μL Glycerol

ECD

Sign In for Pricing
View Details
ICA1 (NM_001136020) Human Over-expression Lysate
LH01900V 100 µg

ICA1 (NM_001136020) Human Over-expression Lysate

Sign In for Pricing
View Details
Olfr1205 Protein Vector (Mouse) (pPB-N-His)
PV208531 500 ng

Olfr1205 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
CC056 rabbit pAb
E44H16316 100 µL

CC056 rabbit pAb

Sign In for Pricing
View Details
Recombinant Human ERVW-1/HERV-W-Env Protein, N-His
E55P7864 50 µg

Recombinant Human ERVW-1/HERV-W-Env Protein, N-His

Sign In for Pricing
View Details
Hpa I
6032050 50 Reactions

Hpa I

Sign In for Pricing
View Details