Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial pyruvate carrier 1 (MPC1), partial

This Recombinant Human Mitochondrial pyruvate carrier 1 (MPC1), partial spans the amino acid sequence from region 72-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mitochondrial pyruvate carrier 1; Brain protein 44-like protein; MPC1 BRP44L CGI-129 HSPC040 PNAS-115

UniProt

Q9Y5U8

Expression Region

72-109

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KVQPRNWLLFACHATNEVAQLIQGGRLIKHEMTKTASA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SR1001 10mg
A13193-10 10 mg

SR1001 10mg

Sign In for Pricing
View Details
ORC1 Rabbit Polyclonal Antibody (Fluoro488)
orb3109828 100 µg

ORC1 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Chd2 (NM_001107523) Rat Untagged Clone
RN214356 10 µg

Chd2 (NM_001107523) Rat Untagged Clone

Sign In for Pricing
View Details
Vmn1r77 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3075307 1.0 µg DNA

Vmn1r77 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
GLOD4 Rabbit Polyclonal Antibody
TA345069 100 µL

GLOD4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PTBP1 Rabbit Polyclonal Antibody
orb1544784-01 50 μL

PTBP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details