Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myosin-4 (MYH4), partial

This Recombinant Human Myosin-4 (MYH4), partial spans the amino acid sequence from region 86-782. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Myosin-4; Myosin heavy chain 2b; MyHC-2b; Myosin heavy chain 4; Myosin heavy chain IIb; MyHC-IIb; Myosin heavy chain, skeletal muscle, fetal; MYH4

UniProt

Q9Y623

Expression Region

86-782

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNPEVVTAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAVTGEKKKEEPASGKMQGTLEDQIISANPLLEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVTFQLKAERSYHIFYQILSNKKPELIEMLLITTNPYDFAFVSQGEITVPSIDDQEELMATDSAVDILGFTADEKVAIYKLTGAVMHYGNMKFKQKQREEQAEPDGTEVADKAAYLTSLNSADLLKSLCYPRVKVGNEFVTKGQTVQQVYNAVGALAKAIYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTSFKNKLYEQHLGKSNNFQKPKPAKGKPEAHFSLVHYAGTVDYNIAGWLDKNKDPLNETVVGLYQKSAMKTLAFLFSGAQTAEAEGGGGKKGGKKKGSSFQTVSALFRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYADFKQRYKVLNASAIPEGQFIDSKKASEKLLGSIEIDHTQYKFGHTKVFFKAGLLGTLEEMRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C5orf19 (REEP2) (NM_016606) Human Tagged Lenti ORF Clone
RC202507L2 10 µg

C5orf19 (REEP2) (NM_016606) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
NALP1 Antibody
GWB-A00C47 0.05 mg

NALP1 Antibody

Sign In for Pricing
View Details
Recombinant Azotobacter vinelandii Argininosuccinate synthase (argG)
MBS1069436-01 0.02 mg (E-Coli)

Recombinant Azotobacter vinelandii Argininosuccinate synthase (argG)

Sign In for Pricing
View Details
Recombinant Azotobacter vinelandii Argininosuccinate synthase (argG)
MBS1069436-02 0.02 mg (Yeast)

Recombinant Azotobacter vinelandii Argininosuccinate synthase (argG)

Sign In for Pricing
View Details
Recombinant Azotobacter vinelandii Argininosuccinate synthase (argG)
MBS1069436-03 0.1 mg (E-Coli)

Recombinant Azotobacter vinelandii Argininosuccinate synthase (argG)

Sign In for Pricing
View Details
Recombinant Azotobacter vinelandii Argininosuccinate synthase (argG)
MBS1069436-04 0.1 mg (Yeast)

Recombinant Azotobacter vinelandii Argininosuccinate synthase (argG)

Sign In for Pricing
View Details