Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myosin-4 (MYH4), partial

This Recombinant Human Myosin-4 (MYH4), partial spans the amino acid sequence from region 86-782. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Myosin-4; Myosin heavy chain 2b; MyHC-2b; Myosin heavy chain 4; Myosin heavy chain IIb; MyHC-IIb; Myosin heavy chain, skeletal muscle, fetal; MYH4

UniProt

Q9Y623

Expression Region

86-782

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNPEVVTAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAVTGEKKKEEPASGKMQGTLEDQIISANPLLEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVTFQLKAERSYHIFYQILSNKKPELIEMLLITTNPYDFAFVSQGEITVPSIDDQEELMATDSAVDILGFTADEKVAIYKLTGAVMHYGNMKFKQKQREEQAEPDGTEVADKAAYLTSLNSADLLKSLCYPRVKVGNEFVTKGQTVQQVYNAVGALAKAIYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTSFKNKLYEQHLGKSNNFQKPKPAKGKPEAHFSLVHYAGTVDYNIAGWLDKNKDPLNETVVGLYQKSAMKTLAFLFSGAQTAEAEGGGGKKGGKKKGSSFQTVSALFRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYADFKQRYKVLNASAIPEGQFIDSKKASEKLLGSIEIDHTQYKFGHTKVFFKAGLLGTLEEMRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HCG beta Antibody
E18-0177-1 50 µg - 50 µL

HCG beta Antibody

Sign In for Pricing
View Details
OKEH05144-96W - TAB1 ELISA Kit (Mouse)
OKEH05144-96W 96 Well

OKEH05144-96W - TAB1 ELISA Kit (Mouse)

Sign In for Pricing
View Details
Cpne4 AAV siRNA Pooled Vector
16762164 1.0 µg

Cpne4 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Clpx Mouse Gene Knockout Kit (CRISPR)
KN503489 1 Kit

Clpx Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FAM57B HDR Plasmid (h)
sc-408976-HDR 20 µg

FAM57B HDR Plasmid (h)

Sign In for Pricing
View Details
Mouse Monoclonal SP100 Antibody (PCRP-SP100-1B9)
NBP3-13780-100ug 100 µg

Mouse Monoclonal SP100 Antibody (PCRP-SP100-1B9)

Sign In for Pricing
View Details