Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myosin-4 (MYH4), partial

This Recombinant Human Myosin-4 (MYH4), partial spans the amino acid sequence from region 86-782. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Myosin-4; Myosin heavy chain 2b; MyHC-2b; Myosin heavy chain 4; Myosin heavy chain IIb; MyHC-IIb; Myosin heavy chain, skeletal muscle, fetal; MYH4

UniProt

Q9Y623

Expression Region

86-782

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNPEVVTAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAVTGEKKKEEPASGKMQGTLEDQIISANPLLEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVTFQLKAERSYHIFYQILSNKKPELIEMLLITTNPYDFAFVSQGEITVPSIDDQEELMATDSAVDILGFTADEKVAIYKLTGAVMHYGNMKFKQKQREEQAEPDGTEVADKAAYLTSLNSADLLKSLCYPRVKVGNEFVTKGQTVQQVYNAVGALAKAIYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTSFKNKLYEQHLGKSNNFQKPKPAKGKPEAHFSLVHYAGTVDYNIAGWLDKNKDPLNETVVGLYQKSAMKTLAFLFSGAQTAEAEGGGGKKGGKKKGSSFQTVSALFRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYADFKQRYKVLNASAIPEGQFIDSKKASEKLLGSIEIDHTQYKFGHTKVFFKAGLLGTLEEMRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trp63 Recombinant Protein (Mouse)
RP181463 100 µg

Trp63 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
CNGA3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
16453061 1.0 µg DNA

CNGA3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Glutaredoxin-2, Mitochondrial, CT, T135 (GLRX2, GRX2, CGI-133) (MaxLight 405) discontinued
G5012-03-ML405 100 µL

Glutaredoxin-2, Mitochondrial, CT, T135 (GLRX2, GRX2, CGI-133) (MaxLight 405) discontinued

Sign In for Pricing
View Details
OR8B2 Protein Vector (Human) (pPM-C-His)
PV108837 500 ng

OR8B2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
LAF4 (AFF3) (NM_001025108) Human Tagged Lenti ORF Clone
RC213269L4 10 µg

LAF4 (AFF3) (NM_001025108) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Anti Human Antithrombin III Polyclonal Antiserum 100ul
IRBAHUATIIIASER100UL 100 µL

Rabbit Anti Human Antithrombin III Polyclonal Antiserum 100ul

Sign In for Pricing
View Details