Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Solute carrier family 12 member 7 (S12A7), partial

This Recombinant Human Solute carrier family 12 member 7 (S12A7), partial spans the amino acid sequence from region 301-419. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Solute carrier family 12 member 7; Electroneutral potassium-chloride cotransporter 4; K-Cl cotransporter 4; SLC12A7 KCC4

UniProt

Q9Y666

Expression Region

301-419

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DPPDIPVCLLGNRTLSRRSFDACVKAYGIHNNSATSALWGLFCNGSQPSAACDEYFIQNNVTEIQGIPGAASGVFLENLWSTYAHAGAFVEKKGVPSVPVAEESRASALPYVLTDIAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTOR Rabbit Polyclonal Antibody
TA378782 100 µL

MTOR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PAX8 (Renal Cell Marker) (PAX8/1492), 0.2mg/mL
BNUB1492-500 1x 500 µL

PAX8 (Renal Cell Marker) (PAX8/1492), 0.2mg/mL

Sign In for Pricing
View Details
Endomucin (EMCN) (NM_001159694) Human Over-expression Lysate
LC431207 20 µg

Endomucin (EMCN) (NM_001159694) Human Over-expression Lysate

Sign In for Pricing
View Details
BRCA1 (Breast Marker) (BRCA1/1398), CF488A conjugate, 0.1mg/mL
BNC881398-500 1x 500 µL

BRCA1 (Breast Marker) (BRCA1/1398), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-amino-4-cyanobenzoic acid
TRC-A605403-500MG 500 mg

2-amino-4-cyanobenzoic acid

Sign In for Pricing
View Details
MART-1 / Melan-A (A103), CF740 conjugate, 0.1mg/mL
BNC740668-500 1x 500 µL

MART-1 / Melan-A (A103), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details