Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Selenoprotein K (SELK), partial

This Recombinant Human Selenoprotein K (SELK), partial spans the amino acid sequence from region 43-94. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Selenoprotein K; SelK; SELENOK SELK HSPC030 HSPC297

UniProt

Q9Y6D0

Expression Region

43-94

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQDVKKRRSYGNSSDSRYDDGRGPPGNPPRRMGRINHLRGPSPPPMAGGUGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TYR
CSB-CL025394HU 10 μg Plasmid + 200 μL Glycerol

TYR

Sign In for Pricing
View Details
CFTR (Ab-737) Antibody
E11-0860B 100 µg

CFTR (Ab-737) Antibody

Sign In for Pricing
View Details
Tubulin alpha-1C Chain (TUBA1C, Alpha-tubulin 6, Tubulin alpha-6 Chain, TUBA6) (Biotin)
MBS6397481-01 0.1 mL

Tubulin alpha-1C Chain (TUBA1C, Alpha-tubulin 6, Tubulin alpha-6 Chain, TUBA6) (Biotin)

Sign In for Pricing
View Details
Tubulin alpha-1C Chain (TUBA1C, Alpha-tubulin 6, Tubulin alpha-6 Chain, TUBA6) (Biotin)
MBS6397481-02 5x 0.1 mL

Tubulin alpha-1C Chain (TUBA1C, Alpha-tubulin 6, Tubulin alpha-6 Chain, TUBA6) (Biotin)

Sign In for Pricing
View Details
Altizide
MBS5772082 Inquire

Altizide

Sign In for Pricing
View Details
MIER3 Human shRNA Plasmid Kit (Locus ID 166968)
TR303256 1 Kit

MIER3 Human shRNA Plasmid Kit (Locus ID 166968)

Sign In for Pricing
View Details