Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein Wnt-6 (WNT6)

This Recombinant Human Protein Wnt-6 (WNT6) spans the amino acid sequence from region 25-365. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein Wnt-6 WNT6

UniProt

Q9Y6F9

Expression Region

25-365

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPSGLPGTPGPPGPAGSPEGSAAWEWGGCGDDVDFGDEKSRLFMDARHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT3 / Signal Transducer and Activator of Transcription 3 (PCRP-STAT3-2F12), CF740 conjugate, 0.1mg/mL
BNC741907-500 1x 500 µL

STAT3 / Signal Transducer and Activator of Transcription 3 (PCRP-STAT3-2F12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prolactin Receptor (B6.2), CF405S conjugate, 0.1mg/mL
BNC040741-500 1x 500 µL

Prolactin Receptor (B6.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T-Cell Leukemia Marker) (CD7/3737), 0.2mg/mL
BNUB2056-100 1x 100 µL

CD7 (T-Cell Leukemia Marker) (CD7/3737), 0.2mg/mL

Sign In for Pricing
View Details
4-Androsten-17beta-ol-3,6-dione
TRC-A637620-5MG 5 mg

4-Androsten-17beta-ol-3,6-dione

Sign In for Pricing
View Details
2-Amino-3-(2-chlorobenzoyl)-5-ethylthiophene
TRC-A603355-250MG 250 mg

2-Amino-3-(2-chlorobenzoyl)-5-ethylthiophene

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS640403 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details