Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human COMM domain-containing protein 10 (COMDA)

This Recombinant Human COMM domain-containing protein 10 (COMDA) spans the amino acid sequence from region 2-202. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

COMM domain-containing protein 10 COMMD10 HSPC305 PTD002

UniProt

Q9Y6G5

Expression Region

2-202

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AVPAALILRESPSMKKAVSLINAIDTGRFPRLLTRILQKLHLKAESSFSEEEEEKLQAAFSLEKQDLHLVLETISFILEQAVYHNVKPAALQQQLENIHLRQDKAEAFVNTWSSMGQETVEKFRQRILAPCKLETVGWQLNLQMAHSAQAKLKSPQAVLQLGVNNEDSKSLEKVLVEFSHKELFDFYNKLETIQAQLDSLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Reciprocal Shaker (BGI-2507)
BGI-2507 1 Unit

Reciprocal Shaker (BGI-2507)

Sign In for Pricing
View Details
Influenza B NP Matched Antibody Pair Set [IV05-105/RD0F-386]
Z01LS-0523-LS26 5 Plates

Influenza B NP Matched Antibody Pair Set [IV05-105/RD0F-386]

Sign In for Pricing
View Details
Rotavirus, Strains RRV, WA (HRP)
MBS6262442-01 0.1 mL

Rotavirus, Strains RRV, WA (HRP)

Sign In for Pricing
View Details
Rotavirus, Strains RRV, WA (HRP)
MBS6262442-02 5x 0.1 mL

Rotavirus, Strains RRV, WA (HRP)

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. japonica (Rice) PMM Polyclonal Antibody
MBS9000167 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) PMM Polyclonal Antibody

Sign In for Pricing
View Details
Clca5 ORF Vector (Mouse) (pORF)
ORF041451 1.0 µg DNA

Clca5 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details