Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human COMM domain-containing protein 10 (COMDA)

This Recombinant Human COMM domain-containing protein 10 (COMDA) spans the amino acid sequence from region 2-202. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

COMM domain-containing protein 10 COMMD10 HSPC305 PTD002

UniProt

Q9Y6G5

Expression Region

2-202

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AVPAALILRESPSMKKAVSLINAIDTGRFPRLLTRILQKLHLKAESSFSEEEEEKLQAAFSLEKQDLHLVLETISFILEQAVYHNVKPAALQQQLENIHLRQDKAEAFVNTWSSMGQETVEKFRQRILAPCKLETVGWQLNLQMAHSAQAKLKSPQAVLQLGVNNEDSKSLEKVLVEFSHKELFDFYNKLETIQAQLDSLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse FGF23 Protein, N-His
bs-106321P-01 20 µg

Recombinant Mouse FGF23 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse FGF23 Protein, N-His
bs-106321P-02 50 µg

Recombinant Mouse FGF23 Protein, N-His

Sign In for Pricing
View Details
RABEP2 Antibody
MBS9605822-01 0.1 mL

RABEP2 Antibody

Sign In for Pricing
View Details
RABEP2 Antibody
MBS9605822-02 0.2 mL

RABEP2 Antibody

Sign In for Pricing
View Details
RABEP2 Antibody
MBS9605822-03 5x 0.2 mL

RABEP2 Antibody

Sign In for Pricing
View Details
CDC42EP5 siRNA (Mouse)
MBS8206500-01 15 nmol

CDC42EP5 siRNA (Mouse)

Sign In for Pricing
View Details